PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa012357
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 747aa    MW: 83564.3 Da    PI: 6.5583
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58695106PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.4e-2191146156
                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                r+k +++t+eq++e+e+lF+++++p++++r++L+k+lgL  rqVk+WFqNrR++ k
  Lsa012357  91 RKKYHRHTAEQIREMEALFKESPHPDEKQRQQLSKRLGLHPRQVKFWFQNRRTQIK 146
                7999************************************************9877 PP

2START212.51.6e-662654846206
                HHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT... CS
      START   6 aaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg... 88 
                a +elvk+a+a++p+W +s     e++n+de+l++f  ++       +++ea+r++g+v+++l++lv++++d+  q+ e ++    ka+tl+vi++g   
  Lsa012357 265 AVEELVKMAAAADPLWIRSFetgrEILNYDEYLKEFHVQNLskfqhkRHIEASRDCGIVFADLPQLVRSFMDVE-QYEEIFPcmisKAATLDVICNGega 363
                689****************99***************776669********************************.************************* PP

                ...EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHH CS
      START  89 ...galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwllrsl 184
                   g++qlm+ elq+l+plv+ R+++fvRy++ql+a +w+ivd+Svd+ +k+  ++s+ R++++pSg++ie++sngh+kvtw+eh ++++++ h+++r +
  Lsa012357 364 nrnGTVQLMFVELQMLTPLVAtREVYFVRYSKQLSANKWAIVDISVDNIEKNI-DASLSRCRKRPSGCIIEDNSNGHCKVTWIEHLECQKSVAHSMYRGI 462
                ***************************************************98.9********************************************* PP

                HHHHHHHHHHHHHHHTXXXXXX CS
      START 185 vksglaegaktwvatlqrqcek 206
                ++sg+a+ga++w+atlq+ ce+
  Lsa012357 463 INSGVAFGARHWMATLQQKCER 484
                ********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.6E-2176149IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-2378142IPR009057Homeodomain-like
PROSITE profilePS5007117.97788148IPR001356Homeobox domain
SMARTSM003897.8E-1990152IPR001356Homeobox domain
PfamPF000461.7E-1891146IPR001356Homeobox domain
CDDcd000866.25E-1795146No hitNo description
PROSITE patternPS000270123146IPR017970Homeobox, conserved site
PROSITE profilePS5084835.091251487IPR002913START domain
SuperFamilySSF559619.89E-33257484No hitNo description
CDDcd088752.44E-103257483No hitNo description
SMARTSM002346.2E-68260484IPR002913START domain
PfamPF018521.1E-50265484IPR002913START domain
Gene3DG3DSA:3.30.530.209.0E-7301480IPR023393START-like domain
SuperFamilySSF559611.18E-11529703No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
MVMSSSNENN PPTSTKDLFP STSLALTLGI FRDIKEAADG RTDDVGANTT VTEISSEYSG  60
PARSRSDDEF DADPDVDDGD DDNNKNKSKK RKKYHRHTAE QIREMEALFK ESPHPDEKQR  120
QQLSKRLGLH PRQVKFWFQN RRTQIKAIQE RHENSLLKSE MDKLRDENRL LRDTIKKGTC  180
PNCGFGSSSK DATNYTDEQQ LRIENSKLKT EIEKLRTSIG KYPKGTSPTN SCSTGNDHEN  240
RSSLDLCSGV FGVETCRIME IVNLAVEELV KMAAAADPLW IRSFETGREI LNYDEYLKEF  300
HVQNLSKFQH KRHIEASRDC GIVFADLPQL VRSFMDVEQY EEIFPCMISK AATLDVICNG  360
EGANRNGTVQ LMFVELQMLT PLVATREVYF VRYSKQLSAN KWAIVDISVD NIEKNIDASL  420
SRCRKRPSGC IIEDNSNGHC KVTWIEHLEC QKSVAHSMYR GIINSGVAFG ARHWMATLQQ  480
KCERFVFFLA TNVPTKDSTG IPTMAGRKSI FKLAERMTWS FSRALGGSSH HTWKKIPSKT  540
GDDIRVASRK NLNDPGEPLG VILCAVSSIW LPVSHTVLFD FLRDETRRNE WDIMSNGGPV  600
QSIANLAKGQ DRGNSVSIHT MKSKENMWMI QDTSTNTYES MVVCAPVCVT NMQSVMGGCD  660
SSNIAILPSG FAILPDGVET RPSLIRSKGQ DQSLEEGGSL LTVGFQILTT DDSTGGKLSV  720
ESVESVDTLI SNTLQNIKAG LQCEDET
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18892KKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002284502.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A118K3H90.0A0A118K3H9_CYNCS; Uncharacterized protein
STRINGVIT_09s0002g04340.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein